PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G087900.3
Common NamePOPTR_0001s10970g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 916aa    MW: 100950 Da    PI: 6.0646
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G087900.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.33.5e-29537588152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek isle+l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Potri.001G087900.3 537 AEKMISLEVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 588
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.78523608IPR003035RWP-RK domain
PfamPF020425.8E-26541588IPR003035RWP-RK domain
SuperFamilySSF542775.56E-21812903No hitNo description
SMARTSM006661.4E-23819901IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.9E-25819900No hitNo description
PROSITE profilePS5174520.353819901IPR000270PB1 domain
CDDcd064072.46E-34820900No hitNo description
PfamPF005643.8E-16820900IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 916 aa     Download sequence    Send to blast
MELDLDLDSS WPLDQISFIS SNPMSTFLIS SSNEQPCSPL WAFSDAADDR LLAAAAGGGN  60
PNSVTESKGE NDDNSKLPSP FLGLMPIDNP DGYCIIKERM TRALRHFKES TEQHILAQVW  120
APVKNGGRYA LTTSGQPFVI DPHSNGLHQY RMVSLMYKFS VDGESDGELG LPGRVFRQKL  180
PEWTPNVQYY SSKEYSRLDH ALHYNVRGTV ALPVFEPSGQ SCVGVVELIM TSQKINYAPE  240
VDKVCKALEA VDLKSSEILD PPSTQICNEG RQNALAEILE ILTMVCETHK LPLAQTWVPC  300
MHRSVLAYGG GLKKSCTSFD GSCNGQVCMS TTDVAFYVVD AHMWGFREAC LEHHLQKGQG  360
VAGRAFFSHN LCFCPDITQF CKTEYPLVHY ARMFGLTSCF AICLRSSYTG DDDYILEFFL  420
PPSFTDSREW KTLLGSILAI MKQDFQSLQV ASGMDLEEEE GFVEMIQVST NGRLDLRLEC  480
IQIPQSTKSP PDDNALLNGP IVQIYPEKKQ LMLDLDVIKN GGKKETKKPK ERKRGKAEKM  540
ISLEVLQQYF TGSLKDAAKS LGVCPTTMKR ICRQHGISRW PSRKIKKVNR SLSKLKRVIE  600
SVQGTEGAFS TSSLPVAVGT ISWPPNLNGR NQQNSPNSKS PEHHGDKNGS PTCRTPGSDV  660
KAELGTGSNR SKTRGGSRGE SAGTPTSHGS CQGCPENESA PAKDPSVSPV HERCIKAGGS  720
PELVLQQTRE LNLSAAYSIP DAFFATEAQE QFGGMLIEDT GSSKDLSNLC PAMADAIVDE  780
RFPESKWTDP PSSDINPTQM IAALSIAMPH VTSRQEMNSV TIKATYREDM IRFRISLSSG  840
IAKLKEEVAK RLRLEVGTFD IKYLDDDHEW ILIARDADLH ECMDVSRSSN SNMIRVSVHD  900
ANANLGSSCE STWEI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299449.10.0RWP-RK domain-containing family protein
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLB9GL230.0B9GL23_POPTR; RWP-RK domain-containing family protein
STRINGPOPTR_0001s10970.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7